PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_012254
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family YABBY
Protein Properties Length: 156aa    MW: 17739.1 Da    PI: 9.6187
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_012254genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY1511.1e-46212632169
        YABBY  32 fkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvirPPekrqrvPsay 129
                   +vvtvrCGhC +l+svn+  + +  + ++          + +  + +++++s    +++  + v+ e+  ++++++ pr+pp irPPekrqrvPsay
  DCAR_012254   2 TTVVTVRCGHCVNLFSVNMGPMLHSPPLQDL---------QRQAANGRRDCSSSS--SDECIKFVALES-AHDQHQQPPRMPP-IRPPEKRQRVPSAY 86 
                  689******************9999888873.........233333333333333..333333333333.5677888899999.9************* PP

        YABBY 130 nrfikeeiqrikasnPdishreafsaaaknWahfPkihfg 169
                  nrfikeeiqrik+  Pdishreafs+aaknWahfP+ih++
  DCAR_012254  87 NRFIKEEIQRIKSVKPDISHREAFSTAAKNWAHFPHIHYD 126
                  **************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046907.6E-511126IPR006780YABBY protein
SuperFamilySSF470954.71E-772121IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.0E-475121IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MTTVVTVRCG HCVNLFSVNM GPMLHSPPLQ DLQRQAANGR RDCSSSSSDE CIKFVALESA  60
HDQHQQPPRM PPIRPPEKRQ RVPSAYNRFI KEEIQRIKSV KPDISHREAF STAAKNWAHF  120
PHIHYDQKRD NSNKLQKSDD HAVAGEITPK THHLY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010651638.12e-61PREDICTED: putative axial regulator YABBY 2 isoform X4
SwissprotQ9XFB02e-53YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLD7T1M72e-60D7T1M7_VITVI; Putative uncharacterized protein
STRINGVIT_06s0009g00880.t015e-60(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38124163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.11e-42YABBY family protein